PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003436P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 287aa    MW: 32351.4 Da    PI: 10.9104
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003436P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.2e-32209262255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  MELO3C003436P1 209 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 262
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.29E-15206262IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-29207262IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-24209262IPR006447Myb domain, plants
PfamPF002494.2E-7210261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNTN KPSSSWRSRT SSSSSSQEDV DLEFWNNKST PKHHLHHLHP  60
HSCFDLSLSN LTQINHHQYP NVSPSPTPNH HHLLHHRHHR YPVLESPAHL FETLNKTHNR  120
PTAIFHHNTQ PPSSSLDPTP TPFPGQINGQ DLGFLRPIRG IPVYHQTNNP SVGTGNGGVV  180
TPSAANHGQI MMRSRFLSRF PAKRSMRAPR MRWTSTLHAR FVHAVELLGG HERATPKSVL  240
ELMDVKDLTL AHVKSHLQMY RTVKTTDRAA AXXXXXXXXQ SSSFFR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466011.10.0PREDICTED: probable transcription factor KAN2
TrEMBLA0A0R0LER31e-78A0A0R0LER3_SOYBN; Uncharacterized protein (Fragment)
TrEMBLA0A0B2PB801e-77A0A0B2PB80_GLYSO; Putative transcription factor KAN2
STRINGPOPTR_0003s09490.14e-71(Populus trichocarpa)
STRINGGLYMA09G34030.25e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59683452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-56G2-like family protein